PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00108.1_g00045.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 244aa    MW: 27978 Da    PI: 9.3431
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00108.1_g00045.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof102.62.3e-322177561
                   zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                              + cprC s+ntkfC+ynny +sqPry C++Crr+Wt+GGalr+vP+Gg  rk k++
  Rsa1.0_00108.1_g00045.1 21 PRVCPRCSSDNTKFCFYNNYRVSQPRYHCRNCRRFWTHGGALRDVPIGGRPRKIKRT 77
                             678**************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-211976IPR003851Zinc finger, Dof-type
PROSITE profilePS5088425.9472276IPR003851Zinc finger, Dof-type
PfamPF027015.5E-292276IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102460IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MGKLNVNVKG NHQVNEEKPP PRVCPRCSSD NTKFCFYNNY RVSQPRYHCR NCRRFWTHGG  60
ALRDVPIGGR PRKIKRTEID QPSVPQAVSN EIQQVNHHEP FSHVQETSQF LEPFGGSSSS  120
AFVGNYFSPL PETHRVMVPP IRSIPPTNRF DLFDGSFHQG YYGAGFNDLV GNHLMNQSFG  180
GHVDNYNSYR VNQENPYMRN QSFTNTMNMN HNASTSERKG YPDTDPINII NNNSNKCVFR  240
SSYR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013647345.11e-135PREDICTED: dof zinc finger protein DOF4.4-like
SwissprotQ9SUA91e-65DOF44_ARATH; Dof zinc finger protein DOF4.4
TrEMBLA0A078CQB71e-133A0A078CQB7_BRANA; BnaA01g10920D protein
STRINGBra013493.1-P1e-133(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16021789
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21050.18e-67Dof-type zinc finger domain-containing protein